DPCstruct | MC30394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N8WIT4 | 77-173 | AEYDAFVGGVDAVISGLANCGSCTSWSVKDGLNALNRGLPTVVAATEHFVGLARTLAADNGRPGLRLVELPSSLNTLPEQQVRAHAR… |
| A0A841J4C5 | 81-184 | AADMTSPDIIADIASRYDAVLLAYGHCGSCTASLVRDAVVLAQTGVPVVAMVTSTFAEEAAFVARASGLPDLPMVILPYPMAGEAPE… |
| W0JTZ5 | 62-166 | None |
| A0A0M3T3C4 | 69-179 | None |
| A0A6F8YR40 | 1-118 | None |
| A0A4Y9QGW3 | 3-86 | None |
| A0A7C4XPG9 | 1-98 | None |
| A0A5A7WEV8 | 87-190 | None |
| A0A7W6F861 | 27-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.