DPCstruct | MC3039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K4AGM7 | 7-76 | PQGSQGCSRKCESSFCAVPPLLRYGKYCGILYSGCPGEKPCDALDACCMVHDHCVDTHNNDYLNTRCNEN |
| C4IYQ7 | 2-85 | YEAMSPRRALLAILLAVALASASSAPQPPPCSRSCAALNCDSLGIRYGKYCGVGWSGCDGEEPCDDLDACCRDHDRCVERKGYV |
| A0A2T7CPA1 | 75-171 | None |
| A0A396HIF9 | 87-181 | None |
| A0A4S4DBT8 | 1-81 | None |
| A0A4U6TKK8 | 116-199 | None |
| A0A6P6FVH2 | 67-159 | None |
| A0A1U8AHA7 | 11-87 | None |
| Q8GZB4 | 8-82 | None |
| A0A6U7EWR1 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.