DPCstruct | MC30383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 343 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 12.22 |
| Pfam Score | 90.59 |
| Assigned Pfam label(s) | PF14088- CL0097- PF09938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9VD86 | 4-106 | LVFDDTGACDLVVDEEIALKVVVDHVFQRLLLIGLMDISPDLPLKRLLSGALNPLFNDGPGLGWHAGSELYIGFKAIPREKVSVVTL… |
| A0A0Q8YF98 | 15-157 | PDAGPNGAPVSDAPVRDRILDVLKGLGIGASIDGDGDLEFAIVDDQGTSTTLFARIAEGDLALVRFFGQWQLAEPVSSDRNERLARC… |
| A0A1Q6KQT7 | 11-185 | None |
| A0P0T8 | 7-143 | None |
| A0A0S6VYZ5 | 251-408 | None |
| A0A068N1G3 | 614-762 | None |
| A0A1M7RCQ1 | 318-466 | None |
| Q8A436 | 17-148 | None |
| A0A4R1YZ49 | 5-154 | None |
| A0A7X1NYF6 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.