DPCstruct | MC30379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1621 |
|---|---|
| Mean domain length (aa) | 207 ± 39 aa |
| Standard deviation of domain lengths | 39.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.35 |
| Mean intra-cluster sequence similarity (%) | 9.66 |
| Pfam Score | 66.62 |
| Assigned Pfam label(s) | CL0023- CL0116- CL0154- CL0020- PF21347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4R2N4 | 4-197 | QPGTRFVYEGTTIEDDGTAVPHRVEINVTDLTKVIAGIRSVVTWDLDYSDDELVEAELAFFAQDNDGNIWRMGEYPEEYDEGEMVDN… |
| A0A2D6KSV6 | 9-202 | LTALQVFEHVQKTYAAMEAMSAKFEEETIMDGQHRVAQGLLQFKKPGLLRQEYFGKDEPDVLQQVIVLDGEMSWAYTPWLNQVTRKA… |
| A0A820D759 | 8-132 | None |
| R6WG54 | 90-283 | None |
| A0A2D6IMF5 | 380-632 | None |
| A0A164XF12 | 2-149 | None |
| A0A1Q7WJW4 | 2-205 | None |
| A0A518I184 | 10-191 | None |
| A0A2N5YLE3 | 85-249 | None |
| A0A6P8GZC5 | 96-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.