DPCstruct | MC30376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 294 ± 43 aa |
| Standard deviation of domain lengths | 43.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5BI25 | 4-285 | LLKVLWILAVYSIHLSSCDDSLERDKHFKYYYKDAITFDESFPRKYFVTKNTEIIAIKCPLGYKVKRNETLTVIYKRPSDSLKESLK… |
| A0A0N5CHE0 | 126-441 | DKMLLGTRPHHKVNIIIGLCPYINWVNKKRWIEFIPEDHIKDNGFFEEENGYAHIVVPLYKKNYDEKEFFCGKLKQPTLPDLLIGYK… |
| A0A0N5BI75 | 1-230 | None |
| A0A0N5A2P0 | 32-259 | None |
| A0A0N4ZZR2 | 1-318 | None |
| A0A0K0E090 | 3-325 | None |
| A0A090LDE4 | 1-265 | None |
| A0A0N4ZQE4 | 165-514 | None |
| A0A0N4ZPQ3 | 179-525 | None |
| A0A0N4ZMF7 | 406-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.