DPCstruct | MC30375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 18.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF01529- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6GXU1 | 223-380 | LFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSGVPEGDGLEWPIREGCHQYSLTIEQLKQKA… |
| A0A0N5BFH3 | 55-222 | KAVIKNKTQIEGFIYDKMMLSQILNDDAKASYPYDLGWWENFSQVFFYGPKPKGNGIWYDTIMGTDNFTLSYIQKMLKSEKISCSRK… |
| A0A6A5DMN4 | 817-986 | None |
| A0A816VUT0 | 208-387 | None |
| A0A1A8C4W3 | 6-170 | None |
| A0A7J7UYU9 | 8-174 | None |
| A0A095AVI4 | 552-712 | None |
| A0A835L8Y4 | 558-747 | None |
| A0A1I7WMG1 | 418-576 | None |
| A0A1I7W384 | 3-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.