DPCstruct | MC30373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 255 ± 48 aa |
| Standard deviation of domain lengths | 48.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 62.50 |
| Assigned Pfam label(s) | CL0036- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1X5K0 | 11-210 | KLCQAVALGNECEKIGECKNSHDLLKFLESKPPDILEECPLYNIYGKCPHGYKCRASKSHTDGEGKLKINDELASKDIVTQFNFISI… |
| A0A0N5B5S4 | 22-250 | VNFNDNNLPSYVKIRLEEEKEDKAAVVGKEEENGEPVRKKPRGMNKGRRKEMDKTRIEISTNQPRLCPSTIFALRNKSYGKEESTDK… |
| U5CZ94 | 130-329 | None |
| A0A6I8NWA1 | 54-390 | None |
| A0A1B0BZT4 | 26-296 | None |
| A0A6P3Y0E0 | 22-398 | None |
| A0A6A3MLN9 | 604-899 | None |
| A0A4S2LHR4 | 1-290 | None |
| A0A183F8C7 | 5-213 | None |
| A0A5N5T367 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.