DPCstruct | MC3037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 208 ± 44 aa |
| Standard deviation of domain lengths | 44.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0PNC7 | 1-211 | MVVALLTAGAAAGALSHPTSEDPAAKTPASIALAYGFKGLSAFLSEAQLTTHLDSIESKENGKLDSREEGICRAVDRISDKSSHVHG… |
| A0A7J7GGQ5 | 3-233 | LIREKIVATLIASGASAGAVTDPNSRDPIGKTPASIAATFGHKGLAGYLSEVALTSHLSSLTLKESELSKGSADVEAENAVNSISQM… |
| A0A3Q7EXJ4 | 5-238 | None |
| A0A444GAQ2 | 498-731 | None |
| A0A427B159 | 53-266 | None |
| A0A2G2VNL1 | 1-220 | None |
| F6H615 | 1-139 | None |
| A0A2G3CTL8 | 1-123 | None |
| A0A7J7LDA5 | 54-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.