DPCstruct | MC30369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0659 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832F6X3 | 1-69 | MTSYSGNGYETASRGAQDPAAALDIWKASPGHNDVLLSQGVWKDYPWGAIGAGFHGGYAVLWFGQEADP |
| A0A7C6MCU5 | 108-174 | YSGDGFEITFSRKGGTNARTAFNSWIRQKSVSSIILNAGNWETISWKAVGVGLHGEFAVIWFGDKED |
| A0A1Y3A5B7 | 92-161 | None |
| A0A7X9KC51 | 128-195 | None |
| A0A233VC44 | 156-235 | None |
| A0A816BUU2 | 87-165 | None |
| A0A816QXR5 | 87-162 | None |
| A0A6I7NV14 | 139-206 | None |
| A0A813LY53 | 660-730 | None |
| A0A1V5B0A1 | 128-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.