DPCstruct | MC30368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0198- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832C014 | 277-384 | ALRPERVFVPGRRDAIRLRPGSSELYLLTRIRDEAHRFAISHHRKRRGKRALVSVLDSVPGVGPAVKKALIKHFGSIAAIKLADVDS… |
| A0A800ERL8 | 24-143 | QELGVTDVALAALAKREELVFRPDRPDPIRLGRKNPALHLLQRLRDEAHRFAVSYNRKLRSKRTLRSDLSQVPGIGPERQKMLLSRF… |
| A0A3T0K545 | 742-850 | None |
| A0A1F8LYM8 | 202-307 | None |
| A0A3B0PT54 | 21-165 | None |
| A0A1V5JRL2 | 1-96 | None |
| A0A6G3V3W3 | 2-70 | None |
| A0A847A2X0 | 1-93 | None |
| A0A3B0Y9A5 | 162-279 | None |
| A0A7C1AXH1 | 11-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.