DPCstruct | MC30367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 230 ± 27 aa |
| Standard deviation of domain lengths | 27.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16989 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3JFF5 | 48-258 | HALWQSITSTPQAESDGRTPLAAVSADMVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRF… |
| A0A832BBQ4 | 25-255 | KALEMRTAWAELIDLGERLLARHRLDLDLQRTTATALLSLDPPAEAAADAIRTRTVELLRRFPGLLDLRSSDGAALADSDTRAWLRA… |
| A4WCZ5 | 160-387 | None |
| A0A2V9ZJL9 | 324-559 | None |
| A0A3C0PDM3 | 211-476 | None |
| A0A2S9XV64 | 778-1025 | None |
| A0A1H6AC59 | 367-604 | None |
| A0A447Y471 | 12-205 | None |
| A0A368E590 | 339-602 | None |
| A0A656SGJ2 | 12-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.