DPCstruct | MC30366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A011P728 | 2-70 | CDAHLKTLVMALQPEWVIGVGAFAETRAREALAGTTVGVGRVLHPSPASPAANRGWAEAASTQLRTLGV |
| A0A831ZN39 | 8-101 | LETSARNRTPDKLSIGDKTRLFAACDRHLQAVVLALSPKLVIALGVFAERQARAALSGTDVKVARILHPSPANPLANRDWHGIVSAE… |
| A0A3N9UNM8 | 166-244 | None |
| A0A1V5LUK6 | 13-87 | None |
| B4NTC8 | 63-156 | None |
| A0A835GG77 | 153-255 | None |
| A0A7M3WBC1 | 1-91 | None |
| A0A7X8WFE2 | 2-79 | None |
| A0A7M7HPT8 | 364-442 | None |
| R7QGW4 | 239-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.