DPCstruct | MC30364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367YGZ6 | 1-138 | MDGQSAILAKTSATSSCTIKVYGCGNGNMLGLDQTLVGQDDDPGYSYSSITGILVLHGSAKLVAFDIGPNYDDDLFELTTHSKALSG… |
| Q5AAL9 | 216-337 | QNFHLVDKDSSMIVQAISTTQTFNVYGFGNGNKIGLTLPLIGIILESAHSYDSSTGILTLRNFLLEQRFNIGLGYDSSKFSVVTDSG… |
| A0A2V1AX46 | 216-335 | None |
| M3JV22 | 212-339 | None |
| A0A421JH57 | 142-249 | None |
| H2AXJ5 | 146-251 | None |
| A0A4Y5MUQ8 | 210-336 | None |
| A0A1A0HGM4 | 1-125 | None |
| A0A1A0H1W6 | 215-328 | None |
| A0A367YCC2 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.