DPCstruct | MC30361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 306 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 68.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF05792- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5A312 | 292-588 | KYTNEFACVNGIYTSIPFTSFFSQPILYDEALAIGADLVRTTSTVIGSITRTTTLPFISRLQKTKTILVLEPIPTTTVTTSHHGFDT… |
| C4YSE0 | 1-302 | MSLLSNIGHNPMPPLLTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDSVIIREPPNHTVTTTEYWSQSYATT… |
| A0A4Q4THF0 | 182-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.