DPCstruct | MC3036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452Z3E0 | 123-259 | LHQMLAEKAFPGHDTSEDWVLSLTSLSGALNGTTRTYYDGMLAEDGRSMKSICLLQLCRLGVIVYDWLDIPWLKNYYNFGFDHFEMS… |
| C0PIQ0 | 3-138 | ADKAFPGHDTSEDWVVSLTSLSGALNGTTRTYYDGMLVVDGRSMKSICLLQLCRLGVIVYDWLDIPWLKNYYNFGFDHYEMSWRKVG… |
| A0A6G1E8E1 | 1-149 | None |
| A0A5D2L3U9 | 29-167 | None |
| A0A151TGF3 | 80-232 | None |
| A0A4Q3K487 | 54-206 | None |
| A0A835R9P1 | 473-615 | None |
| M1ACP6 | 6-152 | None |
| A0A1Y1ZBG6 | 166-305 | None |
| A0A287M7G0 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.