DPCstruct | MC30358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 18.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7YD89 | 10-152 | LGLLIGAAFSVPASIWGIGNPETIIRTARLVDRLLLGCFLFVTAIGAVLLYGLYALGFSMHFSPRPTYLVGVTLGGILFGAGAAVSG… |
| A0A7Y3MSN1 | 2-135 | RPIAFLILGTVFGWTLSRSGAADYNYVQKMFLFEDIQLWGIIATAVILTAPGVWWLKRRGRAALGDSIVVKPKVLHPGNVVGGLIFG… |
| A0A078BM18 | 6-142 | None |
| A0A7L9SAD4 | 2-122 | None |
| A0A0Q9F9H8 | 4-140 | None |
| A0A5C6AFF9 | 13-164 | None |
| A0A059E009 | 3-111 | None |
| A0A382F1H9 | 2-124 | None |
| A0A813WYH1 | 41-217 | None |
| G0AGV0 | 34-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.