DPCstruct | MC30357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3MS56 | 14-119 | DGPVLVVDLSGGTNYTFNPHDVHALDGLGTYYGTFRLAGPFGILEAPGGALMIETKRGRRRVTVPLPNDRDRDTPPVAGPGWTLELA… |
| A0A7V9SLH2 | 45-143 | NGAVLELPILKMSMQMNPGTLVPLESLGTVYPDIRIVDAWGILTVTKGALIKPDFSKIYVSAPSNSSISLIQGDGWMLELNVDWRIT… |
| A0A848QE13 | 152-248 | None |
| A0A2W4ZFH7 | 221-316 | None |
| A0A831SYW5 | 127-221 | None |
| A0A077XSV0 | 2-88 | None |
| W2CAK1 | 1-101 | None |
| A0A2N1KN54 | 411-535 | None |
| A0A7W1CBD9 | 63-166 | None |
| A0A2V8S1L8 | 277-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.