DPCstruct | MC30354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0UQT2 | 39-107 | ISSISNVITYRLCPCDIKLMLYDEVLKVESTWHIRTECPELLSELVEWIRGPWEEMFSIELRKAVYEGL |
| B7QNA9 | 1-74 | MDVSESLAQLEREVHLHEDARRARLTFLDEDRGTESAWTVATETKASLHSLLNSLRTPWEELFGIEMPLALLAR |
| A0A1A9ZQW9 | 604-669 | None |
| L8GDL4 | 415-490 | None |
| A0A4Z2HWQ8 | 392-461 | None |
| A0A4W3I0M5 | 93-166 | None |
| A0A3S3QT10 | 899-961 | None |
| A0A673GPI8 | 761-826 | None |
| A0A5N4E4S0 | 819-891 | None |
| A0A822I362 | 470-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.