DPCstruct | MC30353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 59 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 67.92 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | PF00832- PF08574 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0TB77 | 1-43 | MIKKKLAKKMRQNRPIPHWIRMRTDNKIRYNAKRRHWRRTKLG |
| B7QMT2 | 12-75 | IISFSWISHLSSGKMAAHKTFRIKQKLAKKLKQNRPIPQWIRMRTGNTIRYNAKRRHWRRTKLK |
| A0A286Y079 | 1-51 | None |
| A0A317VAV4 | 5-63 | None |
| A0A340Y5J6 | 1-50 | None |
| A0A6I9J5J7 | 1-51 | None |
| A0A0F7SG38 | 11-79 | None |
| M7WLT0 | 1-51 | None |
| A0A1E3HLV2 | 123-188 | None |
| A0A445AVJ5 | 33-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.