DPCstruct | MC30352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485MMX4 | 1020-1123 | RVIRQPVGRIYFAGTETATHWSGYMEGAVEAGERAAREVLNALGKVAKKDIEVQEPESKDVPAVEITRTFWERNLPSVSGLLKIIGF… |
| B7QJT4 | 13-124 | RFPRSVLRDPIGRLFFAGTETATEWSGYINGGIQAGERAAREVLHAQGKLPKDQVWQKEPPNDLIVSQPFVDTFAEKYMPSVPAFLT… |
| A0A8B6EKZ1 | 733-837 | None |
| A0A7M7N8E4 | 20-131 | None |
| L5K7Y0 | 412-489 | None |
| A0A7R9PSD1 | 102-197 | None |
| A0A819ZFN8 | 72-193 | None |
| A0A7J5Y5R3 | 282-372 | None |
| A0A2H6NKF8 | 5-112 | None |
| A0A4Y2BZU2 | 1098-1196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.