DPCstruct | MC30350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821MK78 | 5-100 | TINNFYLFCIIFQITGQLSPRLFRKLPPRLCVSLRNIVDEEFLREGHVFLGFSKCGRFVLSYTSDVLDDDFAFYSYHLYWWQFQVHS… |
| B7QEA7 | 5-129 | EAPSKQPHNSRQQKPQGLLQKLTLFQIRGTWKRHARDKSSRLFESLPRRLAFRLKDLVSDDVLRAGTVFLGFLADGQFLLSYTLHLE… |
| A7RTR5 | 2-106 | None |
| A0A384DT88 | 104-212 | None |
| A0A423T8D8 | 1-122 | None |
| A0A835G6Z3 | 8-136 | None |
| A0A4Q0A329 | 108-223 | None |
| A0A6P5AG13 | 2-128 | None |
| W5JDM3 | 23-146 | None |
| A0A224YKU8 | 9-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.