DPCstruct | MC3035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3VU92 | 4-105 | FLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVVGNPEEERRAAFYHEPWSQEAVSR… |
| C0PAX8 | 1-100 | MMAFLANTEKHKDIEACDEVISASIKKIHEHRRRRAFFLGFSQSPVEFINALIASQSKDLKLVAGEANRNIEKERRADFYNQPWVED… |
| A0A665VGX1 | 306-416 | None |
| A0A0C9YLK3 | 233-331 | None |
| L0PCB7 | 20-128 | None |
| A0A3R7FPW5 | 563-662 | None |
| A0A2A2LIR1 | 421-525 | None |
| A0A1Y1YJD3 | 631-728 | None |
| A0A2K5E355 | 161-263 | None |
| A0A7J5Z4U1 | 1108-1224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.