DPCstruct | MC30347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452UE17 | 233-384 | AQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEDSPFLKCTLPWGTLSSLKLESRKDSDDGPIMWVRPGEQMIPVADM… |
| B7Q575 | 4-159 | ISQVGRTYRSGTFRCGPLHQMSLVGTVHEEVGGFFPEFLAVLERCPFLRLSMPWGPLSAVEMDSPQESNDGPILWVRPGEQLIPTAE… |
| A0A060X1D4 | 399-551 | None |
| A0A6P6D7Q2 | 287-402 | None |
| A0A2G9R649 | 1-136 | None |
| A0A3Q1EXD6 | 206-344 | None |
| A0A2C9JZT5 | 775-922 | None |
| H2YTT6 | 72-216 | None |
| A0A817U1G0 | 893-1022 | None |
| A0A151NHG8 | 18-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.