DPCstruct | MC30345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 96.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V4TBW3 | 1-89 | MVRNGELKAPVVIGRDHLDTGSVASPNRETESMKDGSDAVSDWPLLNALLNTAGGASWVSLHHGGGVGMGFSQHAGVVIVADGTQAA… |
| A0A7G2SIF0 | 1-94 | MVRNRELSDPILIGRDHLDFGLVTSLNREIESMQADADTASNLTLFNTLLSVTGGAACISVHHGGGVGMKFSQCFEVVTICDGTEEA… |
| A0A7Y2GHZ7 | 1-116 | None |
| A0A644ZMP9 | 46-161 | None |
| J9GVZ7 | 14-129 | None |
| A0A368EZP6 | 47-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.