DPCstruct | MC30344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9A4Y3 | 103-190 | EQTSQYVIRSQPSNICLSTLECAAVTLSILERNEAIQEVLLKPLQALCSFQLQHGALVHHSKEHLIRHGMYDKQMPTNKRKIKRMENL |
| B7Q1P3 | 61-152 | EVQINPNRTSSYVIRTQPTRECLSTVETVAYALSVLEENPQLQELLTRPLQTLCQHQLEHGAVTHHSKEFLIQNGLYAKPLPRRIIH… |
| A0A0L8IA07 | 1-84 | None |
| A0A1A9ZJN5 | 4-85 | None |
| A0A5C6NFI8 | 836-921 | None |
| A0A1B6KI16 | 157-239 | None |
| T1G1P2 | 114-192 | None |
| A0A813N087 | 188-273 | None |
| A0A2I3M2L3 | 103-186 | None |
| A0A6L5D718 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.