DPCstruct | MC3033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835TNP9 | 112-201 | GPRITLSLPSFSGGTPEVPGLLRYACDLTTHVGLVAPLRVTVPPAARGEEESPEQLGAVLGGRPLLCIEFAQMEMRVEEPEALVLAN… |
| C0P8S3 | 20-151 | SESKGGSSTRHLCNISLPFTGSHKDHQWAGPAIRMSLPSFSGRTVDHPDLLKYSCQVECRVRPVKPARIWSARTTEPQQEKSDGEVS… |
| A0A4U5QHQ7 | 525-690 | None |
| A0A2J7ZT97 | 24-153 | None |
| A0A7S3CF47 | 10-101 | None |
| A0A830C7Q0 | 75-211 | None |
| A0A2N9I4I0 | 36-169 | None |
| A0A7N2L9X8 | 2-119 | None |
| A0A4Y7JH75 | 134-257 | None |
| A0A444Y311 | 14-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.