DPCstruct | MC30327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2E149 | 1-83 | MHCHSWLLSPELDDILPPGSNILYFKSLYDVYEEDFSFRQAEERVFGEIRDDIASYPERTGLQRSLKRYLLSGHRVSMGLGFV |
| A0A3D9WVC3 | 218-377 | LYQLGRLQFQRAPLGQRTSAALAAAGLDAAPGTPCLNLHIPDFLGPLSPGACDRSLALATEFFAGHYPDETYSVAACHSWLLDPQLK… |
| A0A3D1FTU6 | 81-222 | None |
| A0A645HXN8 | 3-117 | None |
| A0A841UAA9 | 9-131 | None |
| A0A1H1MH75 | 185-343 | None |
| A0A2N0GN84 | 306-461 | None |
| A0A7X8ZJI9 | 287-410 | None |
| A0A7M2RIK1 | 2-129 | None |
| A0A6I1GBN5 | 420-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.