DPCstruct | MC30322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 242 ± 32 aa |
| Standard deviation of domain lengths | 31.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4I483 | 62-304 | SDAFETAITNFYQSVTPELLEYEMGGGSWITLQVVLDVFFDRSYPTQLRNVTEEYLTLFMVELSPLLKSLPHSPSPEEECQEEYEGN… |
| A0A3N4IKZ0 | 1-148 | MDCAYPSSFRSLIEDYLLVYIRQLHPYFSSLGRAVLITPEPEVDPRVEFIEIVELLGAPGGAISMRCILGLMRDAQLVLLDITMRAL… |
| A0A3N4I7V5 | 24-215 | None |
| A0A3N4I5M6 | 41-237 | None |
| A0A3N4I600 | 3-227 | None |
| A0A3N4I611 | 115-357 | None |
| A0A3N4I6A4 | 26-258 | None |
| A0A3N4I727 | 2-212 | None |
| A0A3N4IA09 | 38-301 | None |
| A0A3N4IH67 | 45-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.