DPCstruct | MC30320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 365 ± 68 aa |
| Standard deviation of domain lengths | 68.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4HVQ9 | 25-321 | GWLDHFIFALAPLGILTAVVSAIRVGGPGWLRAIVGRARENVTTVELELMSSTSEEVCELWNGTGVVRTAGKPEVKEIVCFLVIRVI… |
| D5GMG5 | 55-379 | SQSLTWLEDVIFAMAPLGIVTAIVSAVRVGGPNWLKAIVGRARESRAVAEVELMSSTSHEVCELWNGEAIVRVMGSPEVAEILYFED… |
| A0A6A5TV55 | 3-295 | None |
| A0A4Q4X0P1 | 33-427 | None |
| A0A1L7W8N0 | 18-232 | None |
| Q2GT23 | 2-398 | None |
| A0A5N5X9D1 | 31-359 | None |
| A0A2V1B321 | 9-361 | None |
| A0A175VV69 | 49-471 | None |
| A0A0P7BAW4 | 57-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.