DPCstruct | MC3032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 271 ± 61 aa |
| Standard deviation of domain lengths | 61.23 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5ACV7 | 2-270 | NCKNCNEVLDVNDHFCDNCGAKVIKDRITFRFLMVELFAVLGFDSLFFKTLKKTLQAPHEVLNEYMNGVRRRYVNPFAYLAVGAALS… |
| A0A2E6B3M4 | 4-312 | NPVCPNCFTEKVGPYCTQCGQDARDYRRAFPSIFANVLEESFHFDGRFANTLKLLLLKPGELSREFSLNRRARYVPAVRLYLFTSLL… |
| R6VLR6 | 114-456 | None |
| A0A2T2U9B4 | 60-337 | None |
| A0A1M3D257 | 2-199 | None |
| A0A1Q3WRG6 | 1-223 | None |
| A0A0C1IBG5 | 2-394 | None |
| A0A0Q7EF84 | 6-275 | None |
| A0A5K7SEA6 | 1-217 | None |
| A0A6N9B4W0 | 107-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.