DPCstruct | MC30317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 389 ± 80 aa |
| Standard deviation of domain lengths | 80.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0484 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4H9A3 | 18-372 | RRNESRPPFSIATMGSNFRRFNARVGVVFVLQHRLIRLLQWKTPSHTYAFLAIYFFICLDPSLLAALPFISLLLFLMVPTFIARPPP… |
| A0A4S4LDP6 | 19-271 | PPLYSHPAEGSSEWFSNLQAIQNLMGAVADAHDVVLFTVVPHLTFATSYSYSILAFTTATFLLLLAILPLIPLRPVFLVLGLGLFAL… |
| Q0CDN8 | 11-408 | None |
| A0A0L6W6R1 | 12-382 | None |
| A0A166IEJ2 | 2-401 | None |
| A0A0L0SE94 | 239-624 | None |
| L0P827 | 2-281 | None |
| A0A5K1JYG3 | 2-318 | None |
| A0A507ER83 | 54-447 | None |
| A0A099NUD8 | 1-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.