DPCstruct | MC30315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 388 ± 77 aa |
| Standard deviation of domain lengths | 76.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8XY01 | 415-838 | TIHESLTRKSYIYKSDILVTIQWIVKELYWNDTHLNALVAYYLKGIEQNLRHRCELVRYDELAFRDLENQICNLRNFNKKFPPAITK… |
| A0A1I7TAE8 | 365-828 | YEEAPKFPQILEHYRAFQSSNLYFGIDDLDPYNHTVYRYLGNDGTPFWAKQDFLVKMQSDLFAMFPDMKKPCRQYATIFLKSIEKSL… |
| G0MWL8 | 45-599 | None |
| A0A2G5UQN3 | 10-339 | None |
| G0MWM2 | 6-277 | None |
| G0NHU9 | 38-441 | None |
| G0NHV4 | 277-543 | None |
| G0NHV9 | 484-926 | None |
| A0A2G5UHS4 | 73-508 | None |
| A0A2G5UI38 | 36-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.