DPCstruct | MC30312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 277 ± 67 aa |
| Standard deviation of domain lengths | 66.89 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.83 |
| Pfam Score | 48.37 |
| Assigned Pfam label(s) | PF17675- PF15285- PF04111- CL0551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HT77 | 2-152 | VDDLMHIFVINLNASSETRLMSSSCGCHSVACIAGLHLPDALSFLGHSDIEVSSAIGYVIQVLSLLSRIYNFPYQYGMCFFGSKSTI… |
| A8XKD6 | 20-297 | AIKDVKQKETNLQTLKESIDDEDGLIVQYQRSQDLEAKIEEKEVACRKYKVQIERVQKLILAKRRIMYEVKDKIDKKNQDKQKLIDK… |
| A0A287HIS5 | 41-356 | None |
| A0A2A2KEZ3 | 608-940 | None |
| A0A1R2D226 | 51-351 | None |
| A0A2A2KPL1 | 121-457 | None |
| A0A146ICT4 | 111-438 | None |
| A0A317SIH7 | 5-217 | None |
| F8NTI5 | 4-216 | None |
| A0A3R6VVT9 | 250-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.