DPCstruct | MC30311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 178 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815WHM6 | 1-140 | LIQKLISVLDSVFKKLSRYDEGSFFAQILSLAKPINEDGQAYVLCVNANLEQLRQKISDEIFTLNIFEEWYRQQTQFVFMWLGERTE… |
| A0A3Q3MWU7 | 22-200 | QEFASQIDELIEESVKDMIQLMVAKFVAILEGVLAKISRYDEGTLFSSFMSFTKPGMDVADGYVTFVRHSQDILRDKVNEEVYIERL… |
| A0A060X141 | 63-251 | None |
| A0A663N9W0 | 548-742 | None |
| A0A183QQU7 | 1-145 | None |
| A0A5K4FCT7 | 40-215 | None |
| A0A1W0XEP2 | 275-473 | None |
| A0A0N5B5W8 | 104-328 | None |
| A0A0X3PLV7 | 56-182 | None |
| Q60PC0 | 1133-1348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.