DPCstruct | MC3031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3NEX7 | 14-136 | KGPDDEVTAGGLRVVACRREVGTIDGGISVYVWGQEAGQDVELVRMDLFRTRPHYHAPAERQEETVIPAADSVAWGIEALTTRASEL… |
| A0A2E6A8Y4 | 14-126 | ATERDVGDYRLALVSRDVGADGGPTVHVFGPVAGAREEILRFDCFRKAPHYHLAISYADNPVVAIESEDPLGWTLAELGRHFPDFLE… |
| A0A523M2C2 | 2-109 | None |
| A0A7C7MNN3 | 143-266 | None |
| A0A2V5W6Y3 | 1-116 | None |
| A0A5N9E8D1 | 71-192 | None |
| A0A0S4QKW8 | 2-111 | None |
| A0A2A8HS90 | 30-161 | None |
| A0A6L8A9F0 | 5-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.