DPCstruct | MC30309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 64.43 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF10197- PF15075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3MMM4 | 1-64 | MGGGDLNLKKSWHPQTMKNIERVWKAEQKHEAERKKIEELQKELKDERTREEMTKYAEESGAIK |
| A0A0L0SUD1 | 1-61 | MGGGDLNLKKSWHPQTMRNQERIWKEEQKALEEQRKLQQLQKELAEERAKQELVELQEKAG |
| A0A7M5X1M6 | 1-64 | None |
| A0A6P3HD93 | 1-64 | None |
| A0A7N4P9E4 | 1-74 | None |
| A0A6P8W5S2 | 1-62 | None |
| M7B7B1 | 140-197 | None |
| A0A7R9EUH8 | 1-64 | None |
| Q9VQF5 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.