DPCstruct | MC30308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6D6A0 | 1-95 | MATNYSANQYEKAFSPKYLQNWSLAKPTKESISSYEGYTQIIANDRGHLLPSVPRSKASPWGSFIGTWQMPLKIPPARVTLTARTTA… |
| A0A3Q3M3C3 | 1-145 | MSSSYSANQYESAFRSQKLQNWCETKRFKERPTAQEGHTTFIADDRGHLLPGHFICINKHEYIYTSGGSAWPDFKGTWDLPPRIPAR… |
| A0A177B3N8 | 1-89 | None |
| Q3KPS4 | 2-152 | None |
| B4GW18 | 1-97 | None |
| A0A4S2LIK0 | 1-129 | None |
| A0A075ACK5 | 274-390 | None |
| T2MCC3 | 6-113 | None |
| A0A6P8TKH2 | 16-151 | None |
| A0A819P4D7 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.