DPCstruct | MC30307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02058 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9GDU9 | 5-106 | LVAVVCLCSLVTFSNGVTVKVEDFSFSLESVKQLKFVMDAVPRSPRLRSSRVPYVCSNPLLPAEIKPLCSSPKAPRLVPQLVSIARD… |
| A0A3Q3LEV4 | 11-102 | SPALCLIIAGDRVFPLESVKQLKELMDLDDENISLNLPETSIEAACVNPLLPRIFRPVCRGRRTGIVFSKLVKIITPLDPCEICANA… |
| A0A3Q3LEW9 | 28-134 | None |
| A0A401SM90 | 15-121 | None |
| M7CBK6 | 87-193 | None |
| A0A3Q1GE59 | 9-109 | None |
| A0A6P6P8P7 | 32-137 | None |
| A0A2P4TH33 | 2-89 | None |
| A0A3P8UZJ8 | 73-184 | None |
| A0A673TQS0 | 124-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.