DPCstruct | MC30304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 20.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF18701- PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7D271 | 2-187 | MAKLRDALQNMRDFDIPCGPTSAPQPDEMVVIRWTSDDKNFNVGIKSPVDEKQMDGVPSVKIHSGTDYISNSHLIRWTEVFILQGET… |
| A0A4Y2BL03 | 13-191 | DLTIECGQINAADPEEIVIVQWTRDDKKFNIGVRSPIDGRSFEGIPNLRIHTSTDYAGENYLIRWTEVFFLDVDDCGSSIQNELVDP… |
| A0A6I9XYA6 | 28-220 | None |
| A0A817Z3T9 | 306-474 | None |
| T1K5V6 | 1057-1254 | None |
| A0A4Z2B8K9 | 3-200 | None |
| A0A1L8E309 | 919-1117 | None |
| A0A2H2JLS0 | 1-189 | None |
| A0A6V7W6K7 | 38-257 | None |
| A0A2B4SLW9 | 135-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.