DPCstruct | MC303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9XYN0 | 9-91 | TTPEHTRAARETLGAGPLLVPEQKVVFDTDPGRARALARESAEYYLRLRNYVNNFKRLGFTDEDVAGSGSDALLDALIAQGGA |
| A0A534U150 | 48-130 | VPPEHTAKVRAQIGSHPWLCVEQAVILEADAAKARAAARQFMSLYIPNLPNYVNNLRALGYSDADFQNGCSDRLVDAIVAWGT |
| A0A2S4XHW3 | 163-275 | None |
| A0A535AJP4 | 1-82 | None |
| A0A076N0Q4 | 101-183 | None |
| A0A6G3VT05 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.