DPCstruct | MC30294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 70.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9I0H9 | 1-105 | MAKTCYTAAGNRWPNFIAVDFYKRSDSGGAPEAVDVVNGNLVCGCGNIAKCKANMTFGVCDIPEAGVVPEQGSVAHKSSFAYLDSRP… |
| A0A0A9L3U0 | 1-113 | MVQACYAAAGNKIPNFIAVNFYMRSDGGGVFDVQDRINGLTLCGCNTIAACQAGAPMGACKNIGAPNRTPSSSSSSVNGNVYSGTIE… |
| A0A2U1LI94 | 1128-1239 | None |
| A0A164UBF2 | 170-275 | None |
| A0A2U1KWB8 | 449-556 | None |
| A0A314Z7H2 | 63-165 | None |
| A0A6S7KYE6 | 302-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.