DPCstruct | MC30292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 306 ± 67 aa |
| Standard deviation of domain lengths | 67.08 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03189 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3AFX0 | 2-208 | VLIVLTIAVIILFFVAVTNDDYFDIGVIMNSSFELAVLILMIIIVIAAYFQTSKLDVNTHPMSMLDDVLLFIAIPAFFLETIFSMVP… |
| A0A1I8GUM5 | 57-340 | VGDHRMVEAKQSAPAETNANCESEETGENSRLRQRSNSSGDNREERAEKADWMRQLNIELTVRDLIGPAIGAAAFIVTLAVCICVLS… |
| A0A7R9PVH6 | 234-490 | None |
| A0A1I8IIF4 | 466-756 | None |
| A0A182TXJ8 | 32-298 | None |
| A0A182TDK6 | 364-655 | None |
| R7UET6 | 2-275 | None |
| A0A3P7C1B7 | 52-338 | None |
| D2A3K9 | 276-645 | None |
| A0A368G4Z2 | 9-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.