DPCstruct | MC30290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 242 ± 20 aa |
| Standard deviation of domain lengths | 20.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF20053- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8GNA5 | 1-272 | LGSLACLASLLPCRCAIPCLLAAAWWHFGLLFASEVTFGGILRLASGVGLAFVAPMALPLLLLYILAVVLAHTPAVLFVYLWQAGGL… |
| A0A5F4CN26 | 688-933 | VPYLVCFMWCELSVVILLESTGLGLARATVGYFLFLFALPVLVAGLALMGVLQLARWFLSLELTKVAVTALLCSVPLLFRWWSKASF… |
| F6R022 | 1-215 | None |
| A0A2I0T7F7 | 166-411 | None |
| A0A6V7XR47 | 1-239 | None |
| A0A556U893 | 290-552 | None |
| A0A1I7S857 | 187-414 | None |
| A0A4C1V389 | 381-654 | None |
| A0A4U5M388 | 408-625 | None |
| A0A267EVD8 | 408-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.