DPCstruct | MC3029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 149 ± 24 aa |
| Standard deviation of domain lengths | 24.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CY94 | 2-170 | QQELAELKGLIMQTLEANGQLAKIRASIRASVFNVVDSHDNNEKISPFFSENKKVQSIKELETGRELLELIKEFLKFYEMSYTNSIF… |
| A0A5E4QJT2 | 3-109 | ENKAVSDKELLEAIKNLLKKSDLDKNTIPEPTEEVLLINELVREYLEWNGYLYTASVMVTETAMPSKSKTRGELCAEVGVKDDEKSS… |
| A0A2K6SPQ2 | 2-139 | None |
| W2PW59 | 1-163 | None |
| A0A6P7EBE1 | 11-176 | None |
| A0A7S3ZT05 | 10-145 | None |
| A0A7S1XRD4 | 49-222 | None |
| A0A267GD39 | 1-142 | None |
| A0A834AK31 | 13-181 | None |
| A0A498NND6 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.