DPCstruct | MC30289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 134 ± 26 aa |
| Standard deviation of domain lengths | 26.15 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 41.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8GH66 | 79-195 | LSDRELSLRLNSALTLSGFVESRAALQSAAADVLQEILRERQEAMKKYTCMDYEATCTFLVGSHSDGWGNNLTAINGRTDLDSDMDV… |
| A0A1I8IYP2 | 1-116 | MPSELELSLLLQSTLTKAGFVKARAALQAAVADALQGILRSRRDSFPGIYIVGSYSEGWGNSLTKADGRTDAESDIDVMKLFQGRLY… |
| A0A1I8FSD0 | 677-851 | None |
| A0A1I8HHK7 | 63-228 | None |
| A0A1I8I016 | 9-129 | None |
| A0A1I8H0A1 | 1-106 | None |
| A0A1I8GG44 | 76-234 | None |
| A0A1I8FZ50 | 8-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.