DPCstruct | MC30288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 257 ± 29 aa |
| Standard deviation of domain lengths | 29.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02185 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8GG89 | 16-258 | SSVTAKYKLHARSEPELLDRIVRDLENQKENLKEEMLRLRKLKVGAENLRNAMEKRRAAKEVNREIDTYERLLEEVQNKLAVNGAEL… |
| A0A2H1BWV9 | 13-206 | LQEHDAYARELAVLYGVDPNLSYSNLLEEFKKILDKKRASLQKLYKMKAGVQKIQDSSTIDRRSSRTTTTDVIKELNVDVQDLTQDI… |
| A0A139WKY5 | 1-199 | None |
| A0A1A8C5V9 | 33-336 | None |
| A0A1I8FU06 | 29-300 | None |
| A0A3B5KTR2 | 1-254 | None |
| A0A821EYD0 | 1-276 | None |
| A0A834MBX8 | 14-260 | None |
| A0A2J8MH19 | 16-258 | None |
| A0A0J9XKC2 | 2-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.