DPCstruct | MC30287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 205 ± 22 aa |
| Standard deviation of domain lengths | 22.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8H4B0 | 243-435 | QCVRLLIDRLPDAACTARTALKVLVALKDRQKLEAKRLLREGFGNRPCRVARQIPCELDCDVLEYLGSRDSAWQFSMRFEQPISLAW… |
| A0A1I8JHA9 | 171-368 | RALICLKFGDREAAVKVVSDCRPFSASRGIDWPAERSASEATADLVWRHLKSRDSAWKFCFHIDKRPELPIGNRIVADFVPLQLENY… |
| A0A1I8HFR6 | 364-621 | None |
| A0A1I8HPA3 | 1-208 | None |
| A0A267EG68 | 373-565 | None |
| A0A1I8FSD0 | 1038-1209 | None |
| A0A1I8FET5 | 340-529 | None |
| A0A1I8INA1 | 5-213 | None |
| A0A267GGS3 | 312-520 | None |
| A0A1I8GSW5 | 334-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.