DPCstruct | MC30286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7UN22 | 219-337 | KDALVAESRQFVTDSKMLVSSATHSKEKLVQNVNNSIHTLATLTHLCQITMATMTSLPLAIALGSKVKDVANAYKTTVNAAHNAAGM… |
| A0A1I8G8L1 | 1-153 | DSILKTARALVEDTKKLVAGAASNQEDLAKSAQDAVDSISRLTDTVKFGAASLGTEQSDAQVMLINAARDVASALSEMISATKFAYG… |
| A0A0K0EJV8 | 2064-2213 | None |
| A0A4W5PB03 | 1095-1239 | None |
| A0A2R8QGP7 | 1012-1155 | None |
| A0A061A2H0 | 1-176 | None |
| A0A2H8TJ46 | 505-638 | None |
| H2ZQQ5 | 202-346 | None |
| A0A183AF64 | 10-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.