DPCstruct | MC30283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 519 ± 101 aa |
| Standard deviation of domain lengths | 101.21 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 69.19 |
| Assigned Pfam label(s) | PF02865- PF20979- PF09267- CL0220- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821RS44 | 53-548 | TWLQREAQTLQQYRLDLSEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDLLQTWCEKLAEIIWQNRQQIRRAEHL… |
| A0A1I8G044 | 399-937 | AVSDSYDSDIRSAGASEMAMTLEDEKMAELSVLKAKFEKEPHELVRLMQACLMEESRLLARTAAAESQGPASGAAPKRPSSSDSALL… |
| A0A1E1MX08 | 42-678 | None |
| A0A0D8XCM8 | 2-428 | None |
| A0A3S1BMQ8 | 2-559 | None |
| A0A2B4S7F2 | 386-781 | None |
| A0A6I8PQY1 | 282-911 | None |
| A0A835NJ91 | 101-796 | None |
| A0A0G2JX93 | 378-1015 | None |
| L8HD01 | 300-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.