DPCstruct | MC30280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819CWV8 | 4-107 | NATISRKALGRASQLGYLYDARKEEFCGISLFKNELPTTIVSSIDVPHTQFEYDFSDTFEQKFKKLDVQAQLKVSVLAGLFKLEGSG… |
| A0A1I8FXQ9 | 39-138 | SMSAAQLRIPGLGRSFTLGSLYNTKTNELIQGIKIFSREELENMVCKHRNDSMECEFVKENSMSDRAKNLDISGELSLSLLSGFITA… |
| A0A817LLD6 | 4-119 | None |
| A0A4W3GZ22 | 6-101 | None |
| A0A7J5YUD5 | 157-259 | None |
| A0A7M5XEN6 | 109-229 | None |
| A0A7J6D8E7 | 148-254 | None |
| A0A7R8ZXA4 | 169-254 | None |
| A0A0F8CZ11 | 3-95 | None |
| A0A6G0HX93 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.